PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v1803080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family BES1
Protein Properties Length: 302aa    MW: 32684.6 Da    PI: 9.9407
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v1803080.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF8222169.1e-6761461145
           DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspessl 94 
                      g++gr ptwkErEnnkrRERrRRaiaaki++GLRaqGn+klpk++DnneVlkALc+eAGw+ve+DGttyrkg++++   e++g+  ++s +ss+
  Lj2g3v1803080.1   6 GSTGRLPTWKERENNKRRERRRRAIAAKIFTGLRAQGNFKLPKHCDNNEVLKALCAEAGWIVEEDGTTYRKGCRRP-PIEIGGTPPNMSACSSI 98 
                      5899************************************************************************.9**************** PP

           DUF822  95 qsslkssalaspvesysaspksssfpspssldsislasaasllpvlsvlsl 145
                      q s++ss+++spv+sy+asp+sssfpsp+++d  +++    llp++++ ++
  Lj2g3v1803080.1  99 QPSPQSSSFPSPVPSYHASPTSSSFPSPTRMDASPSS---FLLPFIRNITS 146
                      ********************************99874...67777777655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056875.1E-638131IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MAGGGGSTGR LPTWKERENN KRRERRRRAI AAKIFTGLRA QGNFKLPKHC DNNEVLKALC  60
AEAGWIVEED GTTYRKGCRR PPIEIGGTPP NMSACSSIQP SPQSSSFPSP VPSYHASPTS  120
SSFPSPTRMD ASPSSFLLPF IRNITSIPTN LPPLRISNSA PVPPPLSSPR SSKRKADFEP  180
FSNGSFNAFR HPLFATSAPS SPSRRHHVAT STIPECDESD ASTVDSGRWV SFQTTPASAA  240
AAPPSPTFNL VKPAIQMITP QSSMDMNEGL PWGSGAEIGR GSDFDFENGR VKPWEGERIH  300
EV
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.33780.0cell culture| pod| protoplast| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1410020.0BT141002.1 Lotus japonicus clone JCVI-FLLj-10N24 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015964060.11e-146PREDICTED: BES1/BZR1 homolog protein 2
SwissprotQ94A431e-100BEH2_ARATH; BES1/BZR1 homolog protein 2
TrEMBLG7KC601e-137G7KC60_MEDTR; Brassinazole-resistant 1 protein
STRINGPOPTR_0005s12790.11e-135(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127534105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.27e-62BES1 family protein